PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00069363001
Common NameGSBRNA2T00069363001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 356aa    MW: 39559.1 Da    PI: 9.1712
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00069363001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-38112170361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e+alkcprC+stntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk++
  GSBRNA2T00069363001 112 EAALKCPRCESTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRK 170
                          6789****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3795169IPR003851Zinc finger, Dof-type
PfamPF027013.5E-32114169IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.339115169IPR003851Zinc finger, Dof-type
PROSITE patternPS013610117153IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MVFSSLPVNQ FDSHNWQQVI NIYDTIFFLS SRIYHEIYND DLFGCFSCIT FLKTKYYVNM  60
QQGNTQQLDR VTSDQNPLQH FSSPPAAQAG SSQARVNSMV ERARIAKIPL PEAALKCPRC  120
ESTNTKFCYF NNYNLTQPRH FCKTCRRYWT RGGALRNVPV GGGFRRNKRK KPNGGGRSKA  180
TVAVSADNNN TTSLLSCHPS YSNPSKFLSY GQMPGFNSNL PILPPFQSLG YYNSSNIGLD  240
WSSSGGIVDP WRISSLQQAQ QFPFLINAKG LEQPSTVMYP SLECNEGTAQ ARNVKAEEND  300
QGGNGLNNFS RNFLGNINIK PVEENDGYTS WGGSSNISSS WTGFTSNNST GHLSF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164171RRNKRKKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00069363001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013708600.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
RefseqXP_013708601.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X2
SwissprotQ9M2U11e-144DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A078HTY70.0A0A078HTY7_BRANA; BnaA09g34950D protein
STRINGBra007156.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.31e-134OBF-binding protein 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]